PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010087666.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NF-YB
Protein Properties Length: 165aa    MW: 18101.3 Da    PI: 7.0563
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010087666.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB161.41.3e-50190897
           NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                    +Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yr++eg++
  XP_010087666.1  1 MPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRDAEGDR 90
                    8***************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.17E-36196IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.8E-46197IPR009072Histone-fold
PfamPF008089.8E-26164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.1E-172846No hitNo description
PROSITE patternPS0068503147IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.1E-174765No hitNo description
PRINTSPR006155.1E-176684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MPIANVIRIM RKILPPHAKI SDDAKETIQE CVSEYISFIT GEANERCQRE QRKTITAEDV  60
LWAMSKLGFD DYIEPLTLYL HRYRDAEGDR SGSSSSSAVS MRGDVVPFMK RAVDYGSVAA  120
FAPAAAFHHN GFFGYFKDNN GSGAGGSGNN SLAAVSKGEQ HGQYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-37185993NF-YB
4csr_A4e-371851094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B4e-371851094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087666.11e-122Nuclear transcription factor Y subunit B-6
SwissprotQ84W663e-64NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLW9QE121e-122W9QE12_9R
STRINGVIT_00s0956g00020.t012e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.23e-56nuclear factor Y, subunit B6